Return to main results Retrieve Phyre Job Id

Job DescriptionP77326
Confidence2.14%DateThu Jan 5 12:27:45 GMT 2012
Rank88Aligned Residues26
% Identity19%Templated1joga_
SCOP infoFour-helical up-and-down bundle Nucleotidyltransferase substrate binding subunit/domain Family 1 bi-partite nucleotidyltransferase subunit
Resolution2.40

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   65....70.........80.........90......
Predicted Secondary structure 




Query SS confidence 































Query Sequence  SLIQLKLQAGRKLMQAETSRLNTVLDYIDAVT
Query Conservation    




 

 



 
   
 


 


 
 
Alig confidence 










.




.....









Template Conservation    

 
   

.
 
  ..... 

 

  

Template Sequence  DILREALRFGL. IGDXS. . . . . KWVAYRDXRN
Template Known Secondary structure  TTS.
S
.....T
Template Predicted Secondary structure 


.


.....
Template SS confidence 































   82.......90.. ..... ..100.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions