Return to main results Retrieve Phyre Job Id

Job DescriptionP77326
Confidence2.46%DateThu Jan 5 12:27:45 GMT 2012
Rank62Aligned Residues21
% Identity19%Templatec2eo2A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:adult male hypothalamus cdna, riken full-length PDBTitle: solution structure of the insertion region (510-573) of2 fthfs domain from mouse methylenetetrahydrofolate3 dehydrogenase (nadp+ dependent) 1-like protein
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   77..80.........90.........100........
Predicted Secondary structure 











Query SS confidence 































Query Sequence  LMQAETSRLNTVLDYIDAVTATDTSTAPDVIW
Query Conservation 


 
   
 


 


 
 


 
 



 
Alig confidence 









..........



.






Template Conservation 

 

   

..........



.

 



Template Sequence  LTEEEVRKFA. . . . . . . . . . RLNI. DPATITW
Template Known Secondary structure 

..........T

.
STT


Template Predicted Secondary structure 

..........

.



Template SS confidence 































   50......... 60... ......70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions