Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEV9
Confidence50.24%DateThu Jan 5 11:24:23 GMT 2012
Rank26Aligned Residues30
% Identity13%Templatec3ckyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:2-hydroxymethyl glutarate dehydrogenase; PDBTitle: structural and kinetic properties of a beta-hydroxyacid dehydrogenase2 involved in nicotinate fermentation
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30........
Predicted Secondary structure 

















Query SS confidence 





































Query Sequence  MTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVID
Query Conservation 
  



 

 
 





  
   
       
  

Alig confidence 









.......













.





Template Conservation 


 


 
 .......

  

  
   
 . 
   
Template Sequence  IKIGFIGLGA. . . . . . . MGKPMAINLLKEGV. TVYAFD
Template Known Secondary structure 



T.......TTT
.
Template Predicted Secondary structure 



.......


.
Template SS confidence 





































   5....10.... .....20........ .30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions