Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEV9
Confidence20.17%DateThu Jan 5 11:24:23 GMT 2012
Rank113Aligned Residues29
% Identity21%Templatec1d4fD_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:s-adenosylhomocysteine hydrolase; PDBTitle: crystal structure of recombinant rat-liver d244e mutant s-2 adenosylhomocysteine hydrolase
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30........
Predicted Secondary structure 
















Query SS confidence 




































Query Sequence  TDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVID
Query Conservation    



 

 
 





  
   
       
  

Alig confidence 








.......













.





Template Conservation   
 


 
 .......

  

  
   
 . 
 
 
Template Sequence  VAVVAGYGD. . . . . . . VGKGCAQALRGFGA. RVIITE
Template Known Secondary structure 

S.......T
.
Template Predicted Secondary structure 


.......



.
Template SS confidence 




































   214.....220.. .......230...... ...240..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions