Return to main results Retrieve Phyre Job Id

Job DescriptionP76612
Confidence4.74%DateThu Jan 5 12:24:58 GMT 2012
Rank77Aligned Residues24
% Identity29%Templatec2zxeB_
PDB info PDB header:hydrolase/transport proteinChain: B: PDB Molecule:na+,k+-atpase beta subunit; PDBTitle: crystal structure of the sodium - potassium pump in the e2.2k+.pi2 state
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   150.........160.........170.........180...
Predicted Secondary structure 













Query SS confidence 

































Query Sequence  FKGCFFSGQNFSNYDIQYVNWGTSLFDVDTPCIF
Query Conservation 





















 










Alig confidence 













..........









Template Conservation     
 

   
  
..........

  
 


 
Template Sequence  KKACRFSRMWLKNC. . . . . . . . . . GYAEGKPCVV
Template Known Secondary structure 




GGGSTT
..........


SSS


Template Predicted Secondary structure 









..........






Template SS confidence 

































   147..150.........160 .........170
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions