Return to main results Retrieve Phyre Job Id

Job DescriptionP76612
Confidence4.26%DateThu Jan 5 12:24:58 GMT 2012
Rank92Aligned Residues38
% Identity29%Templatec2v6yA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:aaa family atpase, p60 katanin; PDBTitle: structure of the mit domain from a s. solfataricus vps4-2 like atpase
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   71........80.........90.........100.........110.........120.
Predicted Secondary structure 

















Query SS confidence 


















































Query Sequence  DKIDSYNSALQAFSIFCSSTLTHNNIGFDFKLFPEVKLSGEHLETVFKYKN
Query Conservation 


















































Alig confidence 















.............





















Template Conservation   




  


 
 
 .............
 




 
   
      

 
Template Sequence  DAITYYKKAIEVLSQI. . . . . . . . . . . . . IVLYPESVARTAYEQMINEYKK
Template Known Secondary structure  .............
TT
TT
Template Predicted Secondary structure  .............



Template SS confidence 


















































   2930.........40.... .....50.........60......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions