Return to main results Retrieve Phyre Job Id

Job DescriptionP09549
Confidence18.66%DateThu Jan 5 11:02:24 GMT 2012
Rank73Aligned Residues52
% Identity17%Templatec2q5cA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:ntrc family transcriptional regulator; PDBTitle: crystal structure of ntrc family transcriptional regulator from2 clostridium acetobutylicum
Resolution1.49 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   143......150.........160.........170.........180.........190.........200.........210.......
Predicted Secondary structure 






















Query SS confidence 










































































Query Sequence  AYVVQLGALKNADKVNEIVGKLRGAGYRVYTSPSTPVQGKITRILVGPDASKDKLKGSLGELKQLSGLSGVVMGY
Query Conservation     

 

      
      
   
    
          


 


   
  
      
    
  
 
   
Alig confidence 



























...............












........










Template Conservation     
         
    
      
  ...............



       
 ........  

  


 
Template Sequence  GVKIKEFLFSSEDEITTLISKVKTENIK. . . . . . . . . . . . . . . IVVSGKTVTDEAI. . . . . . . . KQGLYGETINS
Template Known Secondary structure  T

SGGGTT

...............
........TT



Template Predicted Secondary structure 







...............
........




Template SS confidence 










































































   115....120.........130.........140.. .......150..... ....160......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions