Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADC1
Confidence14.61%DateThu Jan 5 11:20:33 GMT 2012
Rank20Aligned Residues27
% Identity30%Templatec2vsvB_
PDB info PDB header:protein-bindingChain: B: PDB Molecule:rhophilin-2; PDBTitle: crystal structure of the pdz domain of human rhophilin-2
Resolution1.82 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50
Predicted Secondary structure 



















Query SS confidence 

































Query Sequence  AGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRA
Query Conservation 








    
     
 
        
   
Alig confidence 











.......














Template Conservation    


 
     .......
 
  
 
   
   
Template Sequence  GDLGFTLRGNAP. . . . . . . VQVHFLDPYCSASVA
Template Known Secondary structure  G

SSSSS.......

TTST
Template Predicted Secondary structure 







.......




Template SS confidence 

































   524.....530..... ....540.........550
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions