Return to main results Retrieve Phyre Job Id

Job DescriptionP00959
Confidence30.89%DateThu Jan 5 10:57:21 GMT 2012
Rank163Aligned Residues35
% Identity23%Templatec2p6pB_
PDB info PDB header:transferaseChain: B: PDB Molecule:glycosyl transferase; PDBTitle: x-ray crystal structure of c-c bond-forming dtdp-d-olivose-transferase2 urdgt2
Resolution1.88 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50.
Predicted Secondary structure 

















Query SS confidence 












































Query Sequence  KILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICA
Query Conservation 
  

   

 

 




    
  

 

  
  
  
    
Alig confidence 





...



....






...

















Template Conservation 


   ...    ....

     ... 

 

  




 
   
Template Sequence  RILFVA. . . AGSP. . . . ATVFALA. . . PLATAARNAGHQVVMAAN
Template Known Secondary structure 
...
SS.......TT

Template Predicted Secondary structure 
...



.......



Template SS confidence 












































   2..... ..10. ....... .20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions