Return to main results Retrieve Phyre Job Id

Job DescriptionP46837
Confidence52.49%DateThu Jan 5 12:04:18 GMT 2012
Rank211Aligned Residues37
% Identity22%Templatec3fhgA_
PDB info PDB header:dna repair, hydrolase, lyaseChain: A: PDB Molecule:n-glycosylase/dna lyase; PDBTitle: crystal structure of sulfolobus solfataricus 8-oxoguanine dna2 glycosylase (ssogg)
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   510.........520......... 530.........540......
Predicted Secondary structure 






..............







Query SS confidence 



















. . . . . . . . . . . . . .
















Query Sequence  AGLTRMMAQNIVAWRDENGQ. . . . . . . . . . . . . . FQNRQQLLKVSRLGPKA
Query Conservation   






  

  
   
 ..............
 

  
  
  

 

Alig confidence 



















..............
















Template Conservation    
   

  
   
  
          
        

 
  
 


 

Template Sequence  YRFYNLKAKYIIMAREKVYGRLKEEIKPLADEDQQLARERLLNIKGIGMQE
Template Known Secondary structure 
TTTTT
TTSTT

Template Predicted Secondary structure 













Template SS confidence 


















































   7980.........90.........100.........110.........120.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions