Return to main results Retrieve Phyre Job Id

Job DescriptionP46837
Confidence21.92%DateThu Jan 5 12:04:18 GMT 2012
Rank286Aligned Residues33
% Identity24%Templatec2eq8C_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:pyruvate dehydrogenase complex, dihydrolipoamide PDBTitle: crystal structure of lipoamide dehydrogenase from thermus thermophilus2 hb8 with psbdp
Resolution1.94 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   574.....580.........590.........600.........610.........620
Predicted Secondary structure 











Query SS confidence 














































Query Sequence  PVVERILAATQQALKDLMGNSSELRNLKASDFTDEKFGVPTVTDIIK
Query Conservation    
 


 
      

      
  
 
   
 
  
  

 

  
Alig confidence 




















..............











Template Conservation 
 

 

 
 



  
 


..............  


 
 

  
Template Sequence  PSIRRLARELGVDLTRLRGTG. . . . . . . . . . . . . . LAGRITEEDVRR
Template Known Secondary structure  T

GGG



S..............TTS


Template Predicted Secondary structure 







..............



Template SS confidence 














































   133......140.........150... ......160.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions