Return to main results Retrieve Phyre Job Id

Job DescriptionP39829
Confidence10.71%DateThu Jan 5 12:00:53 GMT 2012
Rank77Aligned Residues27
% Identity37%Templatec3fin0_
PDB info PDB header:ribosomeChain: 0: PDB Molecule:50s ribosomal protein l27; PDBTitle: t. thermophilus 70s ribosome in complex with mrna, trnas2 and ef-tu.gdp.kirromycin ternary complex, fitted to a 6.43 a cryo-em map. this file contains the 50s subunit.
Resolution6.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.....
Predicted Secondary structure 


















Query SS confidence 
































Query Sequence  NIEIRQETPTAFYIKVHDTDNVAIIVNDNGLKA
Query Conservation               


   


 


    
 
Alig confidence 








.....










.






Template Conservation   







.....
 


 


 
.

 

 
Template Sequence  NILVRQRGT. . . . . RFKPGKNVGMG. RDFTLFA
Template Known Secondary structure 

SSS.....SS
TT
.TT

Template Predicted Secondary structure 



.....





.


Template SS confidence 
































   35....40... ......50.... .....60.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions