Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8I1
Confidence51.84%DateThu Jan 5 11:07:53 GMT 2012
Rank96Aligned Residues38
% Identity24%Templatec2pfsA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:universal stress protein; PDBTitle: crystal structure of universal stress protein from nitrosomonas2 europaea
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   42.......50.........60.........70.........80.........90....
Predicted Secondary structure 

















Query SS confidence 




















































Query Sequence  WNIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANRIHGRFGVEVKLH
Query Conservation     
   
    
  





    
        
  
   
     
 
 
 
Alig confidence 


















.....

..........
















Template Conservation     
   
     



 
.....
 ..........
 
  
      




Template Sequence  REEIIRIAEQENVDLIVVG. . . . . SH. . . . . . . . . . STANSVLHYAKCDVLAV
Template Known Secondary structure  TT
S.....
..........

SS
Template Predicted Secondary structure 




.....

..........



Template SS confidence 




















































   96...100.........110.... .. ...120.........130...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions