Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACE0
Confidence32.15%DateThu Jan 5 11:17:59 GMT 2012
Rank42Aligned Residues30
% Identity23%Templated3dm8a1
SCOP infoCystatin-like NTF2-like Rpa4348-like
Resolution1.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   481........490.........500.........510.........520..
Predicted Secondary structure 


















Query SS confidence 









































Query Sequence  MLSHWMVIKDGIISNYQAVVPSTWNSGPRNFNDDVGPYEQSL
Query Conservation   
 
   
 



  



 


 
  


     
  
 

Alig confidence 






















............






Template Conservation           



   
 
 

 ............ 
  
 
Template Sequence  RMALFTQFQNGRLTNLRMVLDTF. . . . . . . . . . . . DLVEQAL
Template Known Secondary structure  TT
............
Template Predicted Secondary structure 

............
Template SS confidence 









































   104.....110.........120...... ...130...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions