Return to main results Retrieve Phyre Job Id

Job DescriptionP76547
Confidence11.86%DateThu Jan 5 12:24:24 GMT 2012
Rank7Aligned Residues41
% Identity7%Templated1zo0a1
SCOP infoAcyl-CoA N-acyltransferases (Nat) Acyl-CoA N-acyltransferases (Nat) Ornithine decarboxylase antizyme-like
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60. ........70.........80.........90.........100.........110.....
Predicted Secondary structure  .















Query SS confidence 






.





















































Query Sequence  FGIGMTF. DYTECWEIGVRDDCLVMTRVKPVHPEYAKHWNMKGVMNDKTRFHADKWVGYSKV
Query Conservation    
    .
     

 
 
 

 
 

 
  
        
 

 
     
  
 
  

Alig confidence 






.









.....














...............








Template Conservation 




 


 
 

 


.....
  
   

  
 
 ...............
  



 
Template Sequence  AALLEFAEEQLRADHVFI. . . . . CFPKNREDRAALLRT. . . . . . . . . . . . . . . FSFLGFEIV
Template Known Secondary structure 



.....


SS
...............TTT

Template Predicted Secondary structure 






.....




...............

Template SS confidence 





























































   157..160.........170.... .....180......... 190........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions