Return to main results Retrieve Phyre Job Id

Job DescriptionP23840
Confidence3.82%DateThu Jan 5 11:39:46 GMT 2012
Rank86Aligned Residues36
% Identity19%Templated1p8aa_
SCOP infoPhosphotyrosine protein phosphatases I-like Phosphotyrosine protein phosphatases I Low-molecular-weight phosphotyrosine protein phosphatases
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.........60.........70.........80.........90...
Predicted Secondary structure 
















Query SS confidence 

















































Query Sequence  TRAKEACENSGHTIDDHFEEILDMVKIGSNAKRALKDIVLSRYACYLVVQ
Query Conservation   

  

   
  
  

         
    
   
  


 






Alig confidence 

















.............











.





Template Conservation    
  

   


 
 
 .............
  
        .



 
Template Sequence  TRSQKVCKSNGVDISKQR. . . . . . . . . . . . . ARQITKADFSKF. DVIAAL
Template Known Secondary structure  S






.............




SS
.SS
Template Predicted Secondary structure 






.............





.

Template SS confidence 

















































   51........60........ .70.........80 ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions