Return to main results Retrieve Phyre Job Id

Job DescriptionP64426
Confidence34.06%DateThu Jan 5 12:08:13 GMT 2012
Rank380Aligned Residues47
% Identity21%Templatec3pg8B_
PDB info PDB header:transferaseChain: B: PDB Molecule:phospho-2-dehydro-3-deoxyheptonate aldolase; PDBTitle: truncated form of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase2 from thermotoga maritima
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   88.90.........100.........110.........120.........130.........140.........150........
Predicted Secondary structure 
































Query SS confidence 






































































Query Sequence  QQAMIDKLDHLQRLGINTVFFQVKPDGTALWPSKILPWSDLMTGKIGENPGYDPLQFMLDEAHKRGMKVHA
Query Conservation 
      

 
   
 


  


  






   
 
  


  
  
  


   
 










Alig confidence 























........................






















Template Conservation         
   
  
   

    ........................
  
 

  
       

   
Template Sequence  REMLMETAHFLSELGVKVLRGGAY. . . . . . . . . . . . . . . . . . . . . . . . KLGEKGLEYLREAADKYGMYVVT
Template Known Secondary structure  TT

........................
.
TT
Template Predicted Secondary structure 





........................







Template SS confidence 






































































   107..110.........120.........130 .........140.........150...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions