Return to main results Retrieve Phyre Job Id

Job DescriptionP64426
Confidence29.56%DateThu Jan 5 12:08:13 GMT 2012
Rank388Aligned Residues62
% Identity16%Templatec3g8cB_
PDB info PDB header:ligaseChain: B: PDB Molecule:biotin carboxylase; PDBTitle: crystal stucture of biotin carboxylase in complex with2 biotin, bicarbonate, adp and mg ion
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   145....150.........160.........170.........180.........190.........200.........210...... ...220...
Predicted Secondary structure 









































.
Query SS confidence 







































































.






Query Sequence  MLDEAHKRGMKVHAWFNPYRVSVNTKPGTIRELNSTLSQQPASVYVQHRDWIRTSGDRFVLDPGIPEVQDWI. TSIVAEV
Query Conservation   
 











 
                                           


  



  
.   
 

Alig confidence 














...........................





























.






Template Conservation   



   
  

 
...........................    
  
     

               
 
 
   
Template Sequence  ILRACKELGIKTVAV. . . . . . . . . . . . . . . . . . . . . . . . . . . HSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISA
Template Known Secondary structure  T
...........................GGGTT
SS
SSGGGTTT
Template Predicted Secondary structure 


...........................


















Template SS confidence 















































































   17..20.........30. ........40.........50.........60.........
 
   224.....230...
Predicted Secondary structure 



Query SS confidence 









Query Sequence  VSRYPVDGVQ
Query Conservation 
  






Alig confidence 









Template Conservation 
    

 

Template Sequence  AEITGAVAIH
Template Known Secondary structure  T

Template Predicted Secondary structure 



Template SS confidence 









   70.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions