Return to main results Retrieve Phyre Job Id

Job DescriptionP64426
Confidence34.23%DateThu Jan 5 12:08:13 GMT 2012
Rank379Aligned Residues52
% Identity19%Templatec3fxtB_
PDB info PDB header:gene regulationChain: B: PDB Molecule:nucleoside diphosphate-linked moiety x motif 6; PDBTitle: crystal structure of the n-terminal domain of human nudt6
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   78.80.........90.........100.........110.........120.........130.........140.........150.......
Predicted Secondary structure 






































Query SS confidence 















































































Query Sequence  SNPTSRARVQQQAMIDKLDHLQRLGINTVFFQVKPDGTALWPSKILPWSDLMTGKIGENPGYDPLQFMLDEAHKRGMKVH
Query Conservation            
      

 
   
 


  


  






   
 
  


  
  
  


   
 









Alig confidence 



































............................















Template Conservation       
   
   
  

  
       





  ............................   

  
   

 

Template Sequence  ALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPIL. . . . . . . . . . . . . . . . . . . . . . . . . . . . QSRFIAPAASLGFCFH
Template Known Secondary structure  TTS


TT

GG............................GGGGTTT
Template Predicted Secondary structure 









............................


Template SS confidence 















































































   65....70.........80.........90.........100 .........110......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions