Return to main results Retrieve Phyre Job Id

Job DescriptionP64426
Confidence75.45%DateThu Jan 5 12:08:13 GMT 2012
Rank325Aligned Residues50
% Identity24%Templatec2p0oA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein duf871; PDBTitle: crystal structure of a conserved protein from locus ef_2437 in2 enterococcus faecalis with an unknown function
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8990.........100.........110.........120.........130......... 140.........150.........160..
Predicted Secondary structure 




























.



Query SS confidence 


















































.






















Query Sequence  QAMIDKLDHLQRLGINTVFFQVKPDGTALWPSKILPWSDLMTGKIGENPGY. DPLQFMLDEAHKRGMKVHAWFNP
Query Conservation        

 
   
 


  


  






   
 
  


  
  
  .


   
 











 
 
Alig confidence 





















........................




.






















Template Conservation 
    

  
   

  




........................ 


       
   
      

 



Template Sequence  NDTIIYIKKXKALGFDGIFTSL. . . . . . . . . . . . . . . . . . . . . . . . HIPLYRQRLTDLGAIAKAEKXKIXVDISG
Template Known Secondary structure  TT

........................



T

Template Predicted Secondary structure 




........................







Template SS confidence 










































































   14.....20.........30..... ....40.........50.........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions