Return to main results Retrieve Phyre Job Id

Job DescriptionP64426
Confidence53.47%DateThu Jan 5 12:08:13 GMT 2012
Rank351Aligned Residues51
% Identity18%Templatec2jisA_
PDB info PDB header:lyaseChain: A: PDB Molecule:cysteine sulfinic acid decarboxylase; PDBTitle: human cysteine sulfinic acid decarboxylase (csad) in2 complex with plp.
Resolution1.6 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8990.........100.........110.........120.........130.........140.........150........
Predicted Secondary structure 
































Query SS confidence 





































































Query Sequence  QAMIDKLDHLQRLGINTVFFQVKPDGTALWPSKILPWSDLMTGKIGENPGYDPLQFMLDEAHKRGMKVHA
Query Conservation        

 
   
 


  


  






   
 
  


  
  
  


   
 










Alig confidence 





















.








..................



















Template Conservation    
   
      
  
  

 .
 


 

 ..................



  
  
       


Template Sequence  EDLERQIGMAEAEGAVPFLVSA. TSGTTVLGA. . . . . . . . . . . . . . . . . . FDPLEAIADVCQRHGLWLHV
Template Known Secondary structure  TT
.BS
TTT

..................B

T
Template Predicted Secondary structure 




.






..................




Template SS confidence 





































































   222.......230.........240... ......250.. .......260.........270..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions