Return to main results Retrieve Phyre Job Id

Job DescriptionP64426
Confidence97.50%DateThu Jan 5 12:08:13 GMT 2012
Rank212Aligned Residues57
% Identity16%Templatec1bplB_
PDB info PDB header:glycosyltransferaseChain: B: PDB Molecule:alpha-1,4-glucan-4-glucanohydrolase; PDBTitle: glycosyltransferase
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   205....210.........220.........230.........240.........250.........260.........270.........280....
Predicted Secondary structure 

























Query SS confidence 















































































Query Sequence  LDPGIPEVQDWITSIVAEVVSRYPVDGVQFDDYFYTESPGSRLNDNETYRKYGGAFASKADWRRNNTQQLIAKVSHTIKS
Query Conservation 


  



  
   
 


  









 


        
   
  
  
      


  
  

  
   

 
Alig confidence 




































..............................












Template Conservation 

  

 
          
    





 
 
    ..............................             
Template Sequence  IDYDHPDVAAEIKRWGTWYANELQLDGFRLDAVKHIK. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FSFLRDWVNHVRE
Template Known Secondary structure 

TTST



GGGS
..............................
Template Predicted Secondary structure 















..............................
Template SS confidence 















































































   201........210.........220.........230....... ..240.........250
 
   285 ....290.
Predicted Secondary structure  .


Query SS confidence 
.





Query Sequence  I. KPGVEF
Query Conservation   .

 
  
Alig confidence 
.





Template Conservation     
    
Template Sequence  KTGKEMFT
Template Known Secondary structure  TS

Template Predicted Secondary structure 



Template SS confidence 







   251.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions