Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABK9
Confidence22.19%DateThu Jan 5 11:15:44 GMT 2012
Rank156Aligned Residues27
% Identity22%Templated1jmxa2
SCOP infoCytochrome c Cytochrome c Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   310.........320 .........330......
Predicted Secondary structure 



........
Query SS confidence 










. . . . . . . .















Query Sequence  FAQTCANCHTQ. . . . . . . . DKAALQKVVAERKQSI
Query Conservation     

  

  ........    
   
   
   
Alig confidence 










........















Template Conservation 
   
 



 

 





  

  

 




 
Template Sequence  LSETCGRCHSGARVALQRRPAKEWEHLVNFHLGQW
Template Known Secondary structure  SSSS
ST




Template Predicted Secondary structure 





Template SS confidence 


































   96...100.........110.........120.........130
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions