Return to main results Retrieve Phyre Job Id

Job DescriptionQ79CP2
Confidence5.71%DateThu Jan 5 12:37:37 GMT 2012
Rank12Aligned Residues28
% Identity36%Templatec3bjrA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative carboxylesterase; PDBTitle: crystal structure of a putative carboxylesterase (lp_1002) from2 lactobacillus plantarum wcfs1 at 2.09 a resolution
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.........40
Predicted Secondary structure 



















Query SS confidence 


































Query Sequence  LRPRLNVRQRKDTGYLPHSSPFSLQFRPAILYSDG
Query Conservation 


































Alig confidence 
















.......










Template Conservation             
 
   .......   
 

  

Template Sequence  IKQKLTATCAQLTGYLH. . . . . . . TNLPAIIIVPG
Template Known Secondary structure 
TTSS

.......



Template Predicted Secondary structure 




.......





Template SS confidence 


































   4.....10.........20 .........30.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions