Return to main results Retrieve Phyre Job Id

Job DescriptionP76076
Confidence14.41%DateThu Jan 5 12:18:15 GMT 2012
Rank15Aligned Residues24
% Identity25%Templatec3lpeF_
PDB info PDB header:transferaseChain: F: PDB Molecule:dna-directed rna polymerase subunit e''; PDBTitle: crystal structure of spt4/5ngn heterodimer complex from methanococcus2 jannaschii
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40.........50.........60.........70.....
Predicted Secondary structure 











Query SS confidence 








































Query Sequence  ETFYGYLVALKTDAETEKLVADINAERKASYQQLAKQNNVS
Query Conservation 
  



  
        

  

  
 
 
  

  

 
Alig confidence 














.................








Template Conservation    
 
 


 




.................



 
 
 
Template Sequence  ENWIGLLIVINPEKS. . . . . . . . . . . . . . . . . EIAKKAGID
Template Known Secondary structure  S


S
TTT
.................TT

Template Predicted Secondary structure 




.................


Template SS confidence 








































   25....30......... 40........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions