Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADQ5
Confidence22.44%DateThu Jan 5 11:21:33 GMT 2012
Rank18Aligned Residues27
% Identity19%Templated1fcdc1
SCOP infoCytochrome c Cytochrome c Two-domain cytochrome c
Resolution2.53

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40......
Predicted Secondary structure 














Query SS confidence 













































Query Sequence  MNTVFLHLSEEAIKRLNKLRGWRKVSRSAILREAVEQYLERQQFPV
Query Conservation 
 

 
 
 

 
  

 

     






 

  

       
Alig confidence 












...................













Template Conservation 
      





...................  

 

  
   
Template Sequence  MGRIAKGYSTADF. . . . . . . . . . . . . . . . . . . EKMAGYFKQQTYQP
Template Known Secondary structure  TTS
...................TS



Template Predicted Secondary structure 


...................




Template SS confidence 













































   54.....60...... ...70.........80
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions