Return to main results Retrieve Phyre Job Id

Job DescriptionP39404
Confidence74.42%DateThu Jan 5 12:00:37 GMT 2012
Rank369Aligned Residues33
% Identity12%Templatec2nx4A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:transcriptional regulator, tetr family protein; PDBTitle: the crystal structure of athe putative tetr-family transcriptional2 regulator rha06780 from rhodococcus sp. rha1.
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   166...170.........180.........190.........200.......
Predicted Secondary structure 











Query SS confidence 









































Query Sequence  RGYSMTQIAEQLKRNIKTIRAHKFNVMSKLGVSSDAGLLEAA
Query Conservation   
 
  


  
 

  

  
   
  



 
   

  
Alig confidence 





















.........










Template Conservation     
   

  



  
 
  .........
 

  
    
Template Sequence  EAANMRDIATEAGYTNGALSHY. . . . . . . . . FAGKDEILRTS
Template Known Secondary structure  TT

T

.........
SS
Template Predicted Secondary structure 













.........


Template SS confidence 









































   28.30.........40......... 50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions