Return to main results Retrieve Phyre Job Id

Job DescriptionP14377
Confidence22.05%DateThu Jan 5 11:34:02 GMT 2012
Rank160Aligned Residues46
% Identity13%Templatec1wa9A_
PDB info PDB header:circadian rhythmChain: A: PDB Molecule:period circadian protein; PDBTitle: crystal structure of the pas repeat region of the2 drosophila clock protein period
Resolution3.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   240.........250.........260.........270.........280.........290.........300.
Predicted Secondary structure 






Query SS confidence 





























































Query Sequence  EKLVALGHLAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSEL
Query Conservation              









 
    
 
                
     

  

  
Alig confidence 
























................




















Template Conservation                  
        ................ 
   
   
      
  

Template Sequence  RNTRIKEDIVKRLAETVSRPSDTVK. . . . . . . . . . . . . . . . QEVSRRCQALASFMETLMDEV
Template Known Secondary structure  S





TTS................
Template Predicted Secondary structure 
................
Template SS confidence 





























































   522.......530.........540...... ...550.........560.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions