Return to main results Retrieve Phyre Job Id

Job DescriptionP14377
Confidence21.52%DateThu Jan 5 11:34:02 GMT 2012
Rank163Aligned Residues23
% Identity35%Templatec1ut8B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:exodeoxyribonuclease; PDBTitle: divalent metal ions (zinc) bound to t5 5'-exonuclease
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   394.....400.........410.........420.........430.....
Predicted Secondary structure 


















Query SS confidence 









































Query Sequence  TDSGKGIAADQLDAIFTPYFTTKAEGTGLGLAVVHNIVEQHG
Query Conservation   
 
 

  
    


 
 
    
 






  
   

Alig confidence 







...................














Template Conservation 






 ...................


 


 


  

Template Sequence  GDNIRGVE. . . . . . . . . . . . . . . . . . . GIGAKRGYNIIREFG
Template Known Secondary structure  TTTB


T...................T


Template Predicted Secondary structure 







...................



Template SS confidence 









































   203......210 .........220.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions