Return to main results Retrieve Phyre Job Id

Job DescriptionP80644
Confidence51.22%DateThu Jan 5 12:33:13 GMT 2012
Rank237Aligned Residues46
% Identity17%Templatec3fijD_
PDB info PDB header:structural genomics, unknown functionChain: D: PDB Molecule:lin1909 protein; PDBTitle: crystal structure of a uncharacterized protein lin1909
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40.........50.........60.........70..
Predicted Secondary structure 
.


























Query SS confidence 

.





































































Query Sequence  MR. VITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIV
Query Conservation 

.

 
 

 
  
 
  

      
   
      

                        
  

 


Alig confidence 

.






...........






















...............













Template Conservation 






   ........... 

   
  


  
 
      ...............     
   




Template Sequence  LKPVIGITGQ. . . . . . . . . . . QRYVDAIQKVGGFPIALPIDDPS. . . . . . . . . . . . . . . TAVQAISLVDGLLL
Template Known Secondary structure 




...........TT




GG...............GT
S
Template Predicted Secondary structure 



...........






...............

Template SS confidence 








































































   3......10.. .......20.........30..... ....40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions