Return to main results Retrieve Phyre Job Id

Job DescriptionP76515
Confidence20.09%DateThu Jan 5 12:23:55 GMT 2012
Rank7Aligned Residues22
% Identity41%Templated3er7a1
SCOP infoCystatin-like NTF2-like Exig0174-like
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   78.80.........90.........100.........110.
Predicted Secondary structure 












Query SS confidence 

































Query Sequence  RSLWYTWGQKETGEWQWTFQVGDLENVNITHWAV
Query Conservation 

 
 
 





 
 




  


  




 
Alig confidence 












............








Template Conservation 



 
    
  ............   
  


Template Sequence  KHXYAGWVPSETG. . . . . . . . . . . . DTXETRWAV
Template Known Secondary structure 



SST............T
Template Predicted Secondary structure 






............
Template SS confidence 

































   65....70....... ..80......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions