Return to main results Retrieve Phyre Job Id

Job DescriptionP76515
Confidence9.88%DateThu Jan 5 12:23:55 GMT 2012
Rank26Aligned Residues29
% Identity45%Templatec3gg2B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:sugar dehydrogenase, udp-glucose/gdp-mannose PDBTitle: crystal structure of udp-glucose 6-dehydrogenase from2 porphyromonas gingivalis bound to product udp-glucuronate
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10. ........20. ........30........
Predicted Secondary structure 

.








.....................



Query SS confidence 

.









. . . . . . . . . . . . . . . . . . . . .
















Query Sequence  GF. LRGKCVPRDL. . . . . . . . . . . . . . . . . . . . . KVNETNAEYLVRKFDAL
Query Conservation 

.
 



  

.....................













 

Alig confidence 

.









.....................
















Template Conservation 
 
 

 

 

   
   
   
    
   
   
              
Template Sequence  GCGYGGSCFPKDVKALIRTAEDNGYRMEVLEAVERVNEKQKSILFDKFSTY
Template Known Secondary structure  SS


SSSTT


TT
Template Predicted Secondary structure 











Template SS confidence 


















































   337..340.........350.........360.........370.........380.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions