Return to main results Retrieve Phyre Job Id

Job DescriptionP76515
Confidence29.92%DateThu Jan 5 12:23:55 GMT 2012
Rank2Aligned Residues39
% Identity31%Templatec3g79A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:ndp-n-acetyl-d-galactosaminuronic acid dehydrogenase; PDBTitle: crystal structure of ndp-n-acetyl-d-galactosaminuronic acid2 dehydrogenase from methanosarcina mazei go1
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20. ........30..... ....40.........50..
Predicted Secondary structure 






............................



.




Query SS confidence 







. . . . . . . . . . . . . . . . . . . . . . . . . . . .













.
















Query Sequence  GKCVPRDL. . . . . . . . . . . . . . . . . . . . . . . . . . . . KVNETNAEYLVRKF. DALEAKCAALENKIIPV
Query Conservation 



  

............................













. 




 


 
  


Alig confidence 







............................













.
















Template Conservation 
 




   
   
   
               
  

              
           


Template Sequence  GHCLTKDTYHLERGVKIGRGELDYPEGADSIYVLARKVNDFMPAHMYNLTVAALERLGKKMDGSKVAM
Template Known Secondary structure  SSTTSS





SS


TTT

STT
Template Predicted Secondary structure 



















Template SS confidence 



































































   291........300.........310.........320.........330.........340.........350........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions