Return to main results Retrieve Phyre Job Id

Job DescriptionP64481
Confidence2.53%DateThu Jan 5 12:08:48 GMT 2012
Rank58Aligned Residues17
% Identity35%Templatec1iq5B_
PDB info PDB header:metal binding protein/protein bindingChain: B: PDB Molecule:ca2+/calmodulin dependent kinase kinase; PDBTitle: calmodulin/nematode ca2+/calmodulin dependent kinase kinase2 fragment
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.........60.........70...
Predicted Secondary structure 











Query SS confidence 





























Query Sequence  LPDIDHPKSFLGQRLKWISKPIARAFGHRG
Query Conservation 




   
 

     

  
     


Alig confidence 





.............










Template Conservation 





.............










Template Sequence  IPRLDT. . . . . . . . . . . . . LILVKAMGHRK
Template Known Secondary structure 


.............T
Template Predicted Secondary structure 


.............
Template SS confidence 





























   334..... 340.........350
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions