Return to main results Retrieve Phyre Job Id

Job DescriptionP75818
Confidence3.15%DateThu Jan 5 12:14:31 GMT 2012
Rank89Aligned Residues33
% Identity24%Templatec1nfoA_
PDB info PDB header:lipid transportChain: A: PDB Molecule:apolipoprotein e2; PDBTitle: apolipoprotein e2 (apoe2, d154a mutation)
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   42.......50... ......60.........70....
Predicted Secondary structure 
............



Query SS confidence 











. . . . . . . . . . . .




















Query Sequence  DNVAQQFYDYRI. . . . . . . . . . . . LHRSNDITALRPYLSDKLATL
Query Conservation 
 

  


 
 ............ 
  
  







 

  
Alig confidence 











............




















Template Conservation 
   
 

 
  
    
 
   

  


 


          
Template Sequence  ELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKEL
Template Known Secondary structure 

SS
Template Predicted Secondary structure 
Template SS confidence 












































   27..30.........40.........50.........60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions