Return to main results Retrieve Phyre Job Id

Job DescriptionP0A921
Confidence6.52%DateThu Jan 5 11:09:12 GMT 2012
Rank17Aligned Residues27
% Identity30%Templatec2w56B_
PDB info PDB header:unknown functionChain: B: PDB Molecule:vc0508; PDBTitle: structure of the hypothetical protein vc0508 from vibrio cholerae2 vsp-ii pathogenicity island
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   129130.........140.........150.........160.......
Predicted Secondary structure 



















Query SS confidence 






































Query Sequence  FRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGR
Query Conservation 





 



   
      
        
  





Alig confidence 








.....





.......











Template Conservation 


 




..... 




.......




 
     
Template Sequence  FRDKSYSAD. . . . . EGGFHP. . . . . . . VEMAICQTSTGE
Template Known Secondary structure 
TT
BTT.....TB



.......
TTS
Template Predicted Secondary structure 




.....





.......




Template SS confidence 






































   45....50... ...... 60.........70.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions