Return to main results Retrieve Phyre Job Id

Job DescriptionP0A921
Confidence2.05%DateThu Jan 5 11:09:12 GMT 2012
Rank99Aligned Residues36
% Identity19%Templatec2fqzC_
PDB info PDB header:hydrolase/dnaChain: C: PDB Molecule:r.ecl18ki; PDBTitle: metal-depleted ecl18ki in complex with uncleaved dna
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30 .........40.........50.
Predicted Secondary structure  ..............







Query SS confidence 














. . . . . . . . . . . . . .




















Query Sequence  MAVYAQEATVKEVHD. . . . . . . . . . . . . . APAVRGSIIANMLQEHDNPFT
Query Conservation                 ..............                 


 
Alig confidence 














..............




















Template Conservation    





 
         


  
   

 
  
     



     
Template Sequence  NRVLTFEDMLQSAMELSRKWNNVSYTDSEKEEIQQSILKQIEKYSDFPYV
Template Known Secondary structure  TTST



TTT
Template Predicted Secondary structure 












Template SS confidence 

















































   243......250.........260.........270.........280.........290..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions