Return to main results Retrieve Phyre Job Id

Job DescriptionP0AER0
Confidence5.78%DateWed Jan 25 15:20:31 GMT 2012
Rank40Aligned Residues21
% Identity38%Templatec2qvtA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:avrl567-d; PDBTitle: structure of melampsora lini avirulence protein, avrl567-d
Resolution2.26 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   199200.........210.........220.........230....
Predicted Secondary structure 


















Query SS confidence 



































Query Sequence  GFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFL
Query Conservation 
  




 




                     
Alig confidence 










...............









Template Conservation 










...............









Template Sequence  GPKLNLARTLG. . . . . . . . . . . . . . . TVNSNMDQHW
Template Known Secondary structure  SS
TTS
...............TT

SS
Template Predicted Secondary structure 




...............




Template SS confidence 



































   91........100. ........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions