Return to main results Retrieve Phyre Job Id

Job DescriptionP00582
Confidence26.40%DateThu Jan 5 10:56:46 GMT 2012
Rank255Aligned Residues37
% Identity22%Templatec3ugsB_
PDB info PDB header:transferaseChain: B: PDB Molecule:undecaprenyl pyrophosphate synthase; PDBTitle: crystal structure of a probable undecaprenyl diphosphate synthase2 (upps) from campylobacter jejuni
Resolution2.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   54.....60.........70.........80.........90.........100.........
Predicted Secondary structure 




















Query SS confidence 























































Query Sequence  KPTHAAVVFDAKGKTFRDELFEHYKSHRPPMPDDLRAQIEPLHAMVKAMGLPLLAV
Query Conservation   
    
 

      
      


 
   
  
  
   
   
   

     
Alig confidence 













...................






















Template Conservation   
 










................... 
   
  

 

   

  


Template Sequence  ELKHLAVVMDGNRS. . . . . . . . . . . . . . . . . . . QGVKTMQKLMEVCMEENISNLSL
Template Known Secondary structure 







...................TT

Template Predicted Secondary structure 





...................



Template SS confidence 























































   3......10...... ...20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions