Return to main results Retrieve Phyre Job Id

Job DescriptionP03959
Confidence3.41%DateThu Jan 5 10:58:06 GMT 2012
Rank27Aligned Residues25
% Identity16%Templatec2l9uA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:receptor tyrosine-protein kinase erbb-3; PDBTitle: spatial structure of dimeric erbb3 transmembrane domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   250.........260.........270.........
Predicted Secondary structure 
Query SS confidence 





























Query Sequence  LTNFVQMLAIFLIPTALCFAFGEVMGDRRQ
Query Conservation 


 
  
 


 
  
           
 
Alig confidence 













.....










Template Conservation 













.....










Template Sequence  VIAGLVVIFMMLGG. . . . . TFLYWRGRRHH
Template Known Secondary structure  .....
Template Predicted Secondary structure 

.....




Template SS confidence 





























   648.650.........660. ........670..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions