Return to main results Retrieve Phyre Job Id

Job DescriptionP30749
Confidence12.63%DateThu Jan 5 11:46:23 GMT 2012
Rank20Aligned Residues62
% Identity16%Templatec3cb4D_
PDB info PDB header:translationChain: D: PDB Molecule:gtp-binding protein lepa; PDBTitle: the crystal structure of lepa
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80.........90.........100.........110........
Predicted Secondary structure 






















Query SS confidence 















































































Query Sequence  RNHNLGDSVNALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYL
Query Conservation 
    
  
  
 

 
  

 
 
  
  

  
  
  
 
 

 
 
 


  
 
 
 
 

  

 
    

 
Alig confidence 




















......................



















.















Template Conservation   
 
 
 

    
  
    ......................  
  



      
    .        
       
Template Sequence  KSTSRGYASLDYNFKRFQASD. . . . . . . . . . . . . . . . . . . . . . MVRVDVLINGERVDALALIT. HRDNSQNRGRELVEKM
Template Known Secondary structure  TTS



......................TT.GGG
Template Predicted Secondary structure 





......................





.
Template SS confidence 















































































   459460.........470......... 480.........490......... 500.........510.....
 
   119120...
Predicted Secondary structure 


Query SS confidence 




Query Sequence  KTRAP
Query Conservation 
  

Alig confidence 




Template Conservation       
Template Sequence  KDLIP
Template Known Secondary structure  S
Template Predicted Secondary structure 


Template SS confidence 




   516...520
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions