Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionP0AG38
DateThu Jan 5 11:28:02 GMT 2012
Unique Job ID4f4bc497b8e95e53

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template c2w8aC_
Top template information
PDB header:membrane protein
Chain: C: PDB Molecule:glycine betaine transporter betp;
PDBTitle: crystal structure of the sodium-coupled glycine betaine2 symporter betp from corynebacterium glutamicum with bound3 substrate
Confidence and coverage
Confidence: 6.5% Coverage: 55%
113 residues ( 55% of your sequence) have been modelled with 6.5% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.........40.........50.........60
Sequence  MLMLFLTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGIALLGL
Secondary structure 



SS confidence 



























































Disorder  ?





























?



























Disorder confidence 



























































 
   .........70.........80.........90.........100.........110.........120
Sequence  HLIIEKMAWLHTLIMVGGGLYLCWMGYQMLRGALKKEAVSAPAPQVELAKSGRSFLKGLL
Secondary structure 


















SS confidence 



























































Disorder 






























?
?????????????????









Disorder confidence 



























































 
   .........130.........140.........150.........160.........170.........180
Sequence  TNLANPKAIIYFGSVFSLFVGDNVGTTARWGIFALIIVETLAWFTVVASLFALPQMRRGY
Secondary structure 








SS confidence 



























































Disorder 
















?




?

































??
Disorder confidence 



























































 
   .........190.........200......
Sequence  QRLAKWIDGFAGALFAGFGIHLIISR
Secondary structure 

SS confidence 

























Disorder  ??




















???
Disorder confidence 

























 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite



Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
If you use the binding site predictions from 3DLigandSite, please also cite:
3DLigandSite: predicting ligand-binding sites using similar structures.
Wass MN, Kelley LA and Sternberg MJ Nucleic Acids Research 38, W469-73 (2010) [PubMed]
 
© Structural Bioinformatics Group
Imperial College London
Lawrence Kelley, Benjamin Jefferys
Disclaimer
Terms and Conditions
Component software
Template detection: HHpred 1.51
Secondary structure prediction: Psi-pred 2.5
Disorder prediction: Disopred 2.4
Transmembrane prediction: Memsat_SVM
Multi-template modelling and ab initio: Poing 1.0