Return to main results Retrieve Phyre Job Id

Job DescriptionP77439
Confidence48.15%DateThu Jan 5 12:29:20 GMT 2012
Rank156Aligned Residues31
% Identity35%Templatec3izcH_
PDB info PDB header:ribosomeChain: H: PDB Molecule:60s ribosomal protein rpl8 (l7ae); PDBTitle: localization of the large subunit ribosomal proteins into a 6.1 a2 cryo-em map of saccharomyces cerevisiae translating 80s ribosome
ResolutionNULL Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   264.....270.........280.........290.........300.........310..
Predicted Secondary structure 


















Query SS confidence 
















































Query Sequence  PTILVAEDLTPSQFLSLDLKNLAGMILEKTGRTSHTLILARASAIPVLS
Query Conservation    



 





 
 

   
 



  

 
















Alig confidence 













..................
















Template Conservation   




 

 



..................
 


 

    


  
Template Sequence  KLVLIANDVDPIEL. . . . . . . . . . . . . . . . . . VVFLPALCKKMGVPYAI
Template Known Secondary structure  SS

SSGGG..................TTT

Template Predicted Secondary structure 



..................



Template SS confidence 
















































   149150.........160.. .......170.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions