Return to main results Retrieve Phyre Job Id

Job DescriptionP60595
Confidence63.43%DateThu Jan 5 12:06:56 GMT 2012
Rank285Aligned Residues29
% Identity21%Templatec3e5nA_
PDB info PDB header:ligaseChain: A: PDB Molecule:d-alanine-d-alanine ligase a; PDBTitle: crystal strucutre of d-alanine-d-alanine ligase from2 xanthomonas oryzae pv. oryzae kacc10331
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10... ......20.........30
Predicted Secondary structure 




.........


Query SS confidence 












. . . . . . . . .
















Query Sequence  MNVVILDTGCANL. . . . . . . . . NSVKSAIARHGYEPKVS
Query Conservation 
 
 


 
    ......... 
    
   
    

Alig confidence 






.




.........
















Template Conservation   

 

 .

 
 
  

  

  
  

   
  
  
Template Sequence  IRVGLIF. GGKSAEHEVSLQSARNILDALDPQRFEPVLI
Template Known Secondary structure  .
SSTTS
TTT
Template Predicted Secondary structure 

.






Template SS confidence 






































   4.....10 .........20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions