Return to main results Retrieve Phyre Job Id

Job DescriptionP60595
Confidence29.22%DateThu Jan 5 12:06:56 GMT 2012
Rank468Aligned Residues30
% Identity13%Templatec2xznB_
PDB info PDB header:ribosomeChain: B: PDB Molecule:rps0e; PDBTitle: crystal structure of the eukaryotic 40s ribosomal2 subunit in complex with initiation factor 1. this file3 contains the 40s subunit and initiation factor for4 molecule 2
Resolution3.93 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.......
Predicted Secondary structure 











Query SS confidence 






































Query Sequence  ADKLFLPGVGTAQAAMDQVRERELFDLIKACTQPVLGIC
Query Conservation   








             
         





Alig confidence 










.........


















Template Conservation 





 

  .........   

 

  
 





 
Template Sequence  PRVLIVTDPRS. . . . . . . . . DFQAIKEASYVNIPVIALC
Template Known Secondary structure 
SS
TTT.........TTTTT



Template Predicted Secondary structure 





.........




Template SS confidence 






































   115....120..... ....130.........140....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions