Return to main results Retrieve Phyre Job Id

Job DescriptionP26649
Confidence3.78%DateWed Jan 25 15:20:46 GMT 2012
Rank60Aligned Residues27
% Identity44%Templatec3o10D_
PDB info PDB header:chaperoneChain: D: PDB Molecule:sacsin; PDBTitle: crystal structure of the hepn domain from human sacsin
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40....... ..50.........60..
Predicted Secondary structure 



...............
Query SS confidence 












. . . . . . . . . . . . . . .














Query Sequence  GNMDEEHRTWFCA. . . . . . . . . . . . . . . RYAWYCQQMMQAREL
Query Conservation 







 


 ...............


 



  

  
Alig confidence 







.



...............














Template Conservation      

  .

  
  

  
      
 
  
 
 






Template Sequence  GNPVEARR. WLRQARANFSAARNDLHKNANEWVCFKCYLSTKL
Template Known Secondary structure 

.GGGTTTT
Template Predicted Secondary structure 

.


Template SS confidence 










































   4442....... 4450.........4460.........4470.........4480...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions