Return to main results Retrieve Phyre Job Id

Job DescriptionP76552
Confidence11.07%DateWed Jan 25 15:21:09 GMT 2012
Rank19Aligned Residues28
% Identity29%Templatec3zy6A_
PDB info PDB header:transferaseChain: A: PDB Molecule:putative gdp-fucose protein o-fucosyltransferase 1; PDBTitle: crystal structure of pofut1 in complex with gdp-fucose2 (crystal-form-ii)
Resolution1.91 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   101........110.........120.........130......
Predicted Secondary structure 






Query SS confidence 



































Query Sequence  CDMGGFFLAKELAGGDVAAWLYSGLILGSMMGPTIV
Query Conservation   




 

  

       






 



 


Alig confidence 





........





















Template Conservation 
  

 ........ 

      

 

  





Template Sequence  PCMGRF. . . . . . . . GNQVDQFLGVLAFAKALDRTLV
Template Known Secondary structure 

SSS........T
Template Predicted Secondary structure 



........

Template SS confidence 



































   36...40. ........50.........60...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions