Return to main results Retrieve Phyre Job Id

Job DescriptionP52126
Confidence92.38%DateWed Jan 25 15:20:57 GMT 2012
Rank341Aligned Residues34
% Identity29%Templated1nlfa_
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases RecA protein-like (ATPase-domain)
Resolution1.95

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   115....120.........130......... 140........
Predicted Secondary structure 









............


Query SS confidence 
























. . . . . . . . . . . .








Query Sequence  GQNVVLSAPTSMGKSAIVDSLLGMG. . . . . . . . . . . . TLKRLVLVV
Query Conservation 
 
  









 
    
   ............    

 
 
Alig confidence 
























............








Template Conservation 
 
  
 
  
 




 
 

   
 
    
        
    
Template Sequence  GTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGELPTGPVIYLP
Template Known Secondary structure  TSSTTSST


TT








Template Predicted Secondary structure 




















Template SS confidence 













































   30.........40.........50.........60.........70.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions