Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABQ0
Confidence92.48%DateWed Jan 25 15:20:22 GMT 2012
Rank289Aligned Residues33
% Identity36%Templatec3h2sA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:putative nadh-flavin reductase; PDBTitle: crystal structure of the q03b84 protein from lactobacillus2 casei. northeast structural genomics consortium target3 lcr19.
Resolution1.78 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   189190.........200.........210.........220.........230.......
Predicted Secondary structure 




















Query SS confidence 
















































Query Sequence  LNIMITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLVSGP
Query Conservation 
 





 
 
 

 

 


 



 
  

      

 
 

 
 
Alig confidence 







................
























Template Conservation   



 

................

 

  

  

  
  
    
 
Template Sequence  XKIAVLGA. . . . . . . . . . . . . . . . TGRAGSAIVAEARRRGHEVLAVVRD
Template Known Secondary structure 
TT................TSTT
S
Template Predicted Secondary structure 


................






Template SS confidence 
















































   1....... .10.........20.........30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions