Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABQ0
Confidence91.31%DateWed Jan 25 15:20:22 GMT 2012
Rank303Aligned Residues65
% Identity12%Templatec3d7lG_
PDB info PDB header:structural genomics, unknown functionChain: G: PDB Molecule:lin1944 protein; PDBTitle: the crystal structure of the protein lin1944 from listeria innocua .
Resolution2.06 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   189190.........200.........210.........220.........230.........240.........250.........260........
Predicted Secondary structure 



































Query SS confidence 















































































Query Sequence  LNIMITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLVSGPVSLPTPPFVKRVDVMTALEMEAAVNASVQQQ
Query Conservation 
 





 
 
 

 

 


 



 
  

      

 
 

 
      
     
 
 
  

   
       
Alig confidence 







...............


.












.









.......





















Template Conservation   






...............
 
.

 


  

  
. 

   
   ....... 
  
                 
Template Sequence  XKILLIGA. . . . . . . . . . . . . . . SGT. LGSAVKERLEKKA. EVITAGRHSG. . . . . . . DVTVDITNIDSIKKXYEQVGKV
Template Known Secondary structure 
TT...............TS.TTTS.SSSS.......S

TT


Template Predicted Secondary structure 


...............

.

.


.......







Template SS confidence 















































































   1....... .10. ........20.... .....30.... .....40.........50......
 
   269270.......
Predicted Secondary structure 



Query SS confidence 








Query Sequence  NIFIGCAAV
Query Conservation 
  
 



Alig confidence 








Template Conservation           
Template Sequence  DAIVSATGS
Template Known Secondary structure 



Template Predicted Secondary structure 



Template SS confidence 








   57..60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions